#ilovebooks instagram facebook twitter pinterest photos videos

ilovebooks instagram facebook twitter photos videos

I was in the mood to read some tender chicken books (thanks @margotmwood for that wonderful reference 😂) so I picked up Unhoneymooners by @christinalauren. Apparently this book puts a gal in heat 🤷🏻‍♀️We will see. LOL. #mynailsaregrossiknow


1💬Normal

ilovebooks instagram facebook twitter photos videos

sick: stories of disease, injury, addiction, mental illness, and the lovesick. subscribe up top if it makes u feel good.


1💬Normal

ilovebooks instagram facebook twitter photos videos

Amanhã é o Dia do Folclore!!!!! E eu quero saber , qual é a sua lenda favorita ??? Amanhã postarei as lendas aqui ! ♥️ Segue 👉🏻 @carol.natale #lendas #folclore #diadofolclore #historias #livros #cultura #leituralibertamente #botocorderosa #saci #boitata #iara #mulasemcabeça #curupira #caipora #lobisomem #negrinhodopastoreio #instaliterario #followme #ilovebooks #history #mermeid


0💬Normal

ilovebooks instagram facebook twitter photos videos

¡No es viernes! 😂 . ¡Y tenemos novedades! 😏 . Separador One more 🔖 . Separador hecho en un material resistente, con un diseño hermoso para acompañar nuestras lecturas de siempre 📖 . Puedes pedirlo a través de un mensaje directo 💌 . Recuerda que somos de Arequipa . Momostore team 🤓


1💬Normal

ilovebooks instagram facebook twitter photos videos

To stick with today's theme of creepy/evil/scary, I've chosen a throwback for today's book recommendation. Hex by Thomas Olde Heuvelt was one of the creepiest books I've read in the past few years. I remember staying up late curled under a blanket saying to myself "wtf just happened" several times and then being creeped out to the point where I didn't want to turn the light off. If you haven't checked this book out yet, but love being scared, pick this book up. Follow me @jchebooks for book recommendations and all things book related. #books #ilovebooks #ilovetoread #booklove #bookaddict #booklover #bibliophile #bookcommunity #biblio #bookblog #bookblogger #bookbloggers #bookstagram #nightmare #bookrecs #bookrecommendations #goodreads #evil #hex #curses #witch #witchcraft #witches #dark #creepy #scary #paranormal #ghosts #devil #demonic


0💬Normal

ilovebooks instagram facebook twitter photos videos

Bukan Ustaz Bukan Peguam Siapakah yang layak untuk menjadi Pegawai Syariah di sesebuah institusi kewangan Islam? Mereka tidak dianggap sebagai Peguam, bukan juga sebagai Ustaz. Namun, seorang Pegawai Syariah memikul tugas agama yang besar, iaitu memartabatkan undang-undang muamalat Islam dalam arus perdana kewangan Negara. Ada yang menyangka dunia kewangan Islam ini indah-indah bekala, berelaun lumayan, bersidang di sana-sini, dan mendapat perhatian lensa media massa. Benarkah begitu? Buku ini memuatkan catatan santai anekdot penulis, berkenaan perjalanan akademik beliau, meniti dari satu kerjaya ke kerjaya yang lain sehinggalah bagaimana penulis boleh ‘mendarat’ dalam dunia institusi kewangan Islam. Para pembaca juga akan dibawa untuk melihat isu-isu kewangan semasa melalui kaca mata seorang pengamal bidang undang-undang dan kewangan Islam, misalnya dalam bab DNA Babi dalam Urusan Kewangan, Indahnya Haram, dan Ayam Sembelih Ayam Tak Sembelih. ========== DR. MOHAMED HADI AH merupakan anak kelahiran Kota Bharu, Kelantan dan dibesarkan di Kuala Lumpur. Latar belakang beliau ialah berkelulusan Ijazah Sarjana Muda Undang-Undang (Kepujian), Ijazah Sarjana Muda Undang-Undang Syariah (Kepujian), Sarjana Undang-Undang Perbandingan dan Doktor Falsafah Undang-Undang, kesemuanya dari Universiti Islam Antarabangsa Malaysia (IIUM). Beliau memulakan kerjayanya sebagai pelatih dalam kamar di sebuah frma guaman korporat di segi tiga emas ibu kota sebelum diterima masuk sebagai Peguambela dan Peguamcara, Mahkamah Tinggi Malaya pada Mac 2010. #sayajualbuku #kedaibuku #bacabuku #instareading #instaread #reads #bookish #booksaddict #sayajual #sayasukabacabuku #sayasukabaca #bookworm #ulatbuku #instabooks #bookstagram #bookslover #ilovebooks #lovebooks #sukamembaca #membaca #malaysiamembaca #sarawakian #sabahan #malaysian #ilhambooks #bukanustazbukanpeguam #peguam #kewanganislam #syariah


0💬Normal

ilovebooks instagram facebook twitter photos videos

⭐️REVIEW⭐️ #TheTigerCatcher by #PaullinaSimons is the story of Julian, whose life changes suddenly one day when he meets a mysterious young woman named Josephine. Julian’s world is turned upside down by a love affair that takes him—and everyone else in his life—by storm. But Josephine is not what she seems and carries secrets that threaten to tear them apart—seemingly forever. After losing Josephine, Julian is totally broken until he meets a mysterious stranger who tells him that he could find Josephine again, if only he is willing to give up everything and take a death-defying trip from which no one has ever returned.⁣ •⁣ I could see that Simons was trying to create this epic romance between two star crossed lovers with this story, and knowing that she brought us Tatiana and Alexander in The Bronze Horseman, I really wanted to love this one. But I just didn’t quite believe it. Given that the book features three of my least favourite things- insta love, a manic pixie dream girl and time travel- I enjoyed it more than I thought I would, but I couldn’t get past the fact that Julian knew Josephine for A FEW MONTHS before literally risking his life and traveling through time to MAYBE find her soul reincarnated in another person on the advice of a very shady stranger he met in a bar while clinically depressed and going through withdrawal from a mind altering drug. And maybe it was because the story was told from Julian’s perspective, but I also just didn’t believe that Josephine actually loved Julian, nor did she seem worth going through all that trouble for!⁣ •⁣ Having said that, as is her way, Simons’ storytelling is beautiful. I love her use of language. She has such a unique style, and a way of making you care about characters that are actually quite unlikeable. When you think about it, a lot of her characters are pretty awful, but somehow, you do still end up caring about what happens to them. In this case, however, I’m not sure that I care enough to pick up the (600+ page!) sequel. Though if someone has read it can you DM me because I still kinda want to know what happens!⁣ •⁣ Have you read this one? What did you think of it?


3💬Normal

ilovebooks instagram facebook twitter photos videos

I was missing out big time for most of my life as I only watched Candyman for the first time like two years ago. So, yeah, I love it. . #colorsofhorror2019 black&yellow for Candyman 🙌 . Also, please enjoy my giant dough hook from the mixer in our bakery. 😂 . #bookstagram #bookstack #booksonbooksonbooks #booksonbooks #booksandbooks #readmorebooks #readmorehorror #promotehorror #horrorbooks #ilovereading #ilovebooks #bookstacks #candyman #farewelltotheflesh #candymancandymancandymancandymancandyman #bees #igreads #instabooks #booksofinsta


1💬Normal

ilovebooks instagram facebook twitter photos videos

Hello, my breathers! 🌊 Today is day 21 of #aestheticwipup 🧜🏻‍♀️ ✨ foolish character ✨ I’d have to say Dylan is one of the more foolish characters in my series, although he’s matured so much since Surrender Your Soul. In SYS Dylan is young and hot-headed. Dylan loves video games and is girl crazy... he’s out for himself. He was Beck’s enemy and by the end of Ashes of the Sea they become besties. Dylan really becomes a loved character. #breatherstrilogy #writing #writerslife #writersofinstagram #youngadult #fantasy #fiction #amreading #reading #readers #readerlife #goodreads #books #booklovers #aesthetic #mermaid #mermaidlife #ilovebooks #ilovereading #booklover #bookworm #bookish #bookgram #booksofig #indieauthor


0💬Normal

ilovebooks instagram facebook twitter photos videos

Maqasid Al-Shariah: Antara Nas Dan Maslahah Suatu Pendekatan Sistem Karya ini cuba membuka dimensi baharu dalam perbahasan hukum Islam melalui pengintegrasian dengan bidang pemikiran sistem. Saya mendapati pendekatan ini amat menarik untuk diamati kerana memperlihatkan sıfat wacana hukum Islam yang dinamik serta kemampuannya untuk berintegrasi dengan disiplin ilmu lain meskipun daripada tradisi yang berbeza. Ini turut membuktikan bahawa, Islam secara asasnya mampu berinteraksi secara positif dan harmonis dengan tradisi keilmuan Barat yang bukan sahaja dalam bentuk pertentangan dan konflik semata-mata. Prof. Madya Dr. Mohamed Azam Mohamed Adil,Timbalan Ketua Pegawai Eksekutif IAIS Malaysia Saya telah meneliti karya yang ditulis oleh saudara kami, Dr. Ahmad Badri Abdullah, dan mendapati beliau telah memberikan sumbangan yang bermanfaat dalam rangka pengaplikasian disiplinmaqasid al-shari’ah, sebagai sebuah kajian lanjutan berkaitan bidang ilmu maqasid dan pemikiran sistem serta pendekatannya yang bersifat komprehensif dalam menangani sebarang isu. Permasalahan mendesak pada pola pemikiran Muslim dalam era moden ialah pemikiran berbentuk terpisah-pisah, reduksionis serta sempit. Bentuk pemikiran tersebut melihat realiti hanya menerusi limitasi sudut pandang yang sempit, dan hanya menilai sebarang peristiwa melalui perbandingan luaran yang cetek. Prof. Dr Jasser Auda, Presiden dan Pengasas Maqasid Institute Global #sayajualbuku #kedaibuku #bacabuku #instareading #instaread #reads #bookish #booksaddict #sayajual #sayasukabacabuku #sayasukabaca #bookworm #ulatbuku #instabooks #bookstagram #bookslover #ilovebooks #lovebooks #sukamembaca #membaca #malaysiamembaca #sarawakian #sabahan #malaysian #ilhambooks #maqasidalshariah #ahmadbadriabdullah


0💬Normal

ilovebooks instagram facebook twitter photos videos

📖 masih dibaca dengan saaaaaangat santai 🍃


1💬Normal

ilovebooks instagram facebook twitter photos videos

CLEARANCE SALE! ✨ Starts today until August 16. • Get our Six of Crows: The Dregs and Aurora Rising #squad312 magnetic bookmark sets today and get a 20%-30% OFF! 🛍 Available now via our Shopee (treasureloot.ph)


1💬Normal

ilovebooks instagram facebook twitter photos videos

Melangkah Ke Hadapan: Landskap Muslim Demokrat Di Malaysia Walaupun politikal Islam dilihat sebagai satu kuasa yang cuba bersaing secara demokrasi dengan parti-parti liberal-sekular di kalangan Muslim yang lainnya, kelompok Islam sering ditanggap sebagai kelompok yang tidak boleh dipercayai kerana kelompok liberal-sekular mendakwa politikal Islam hanya menggunakan demokrasi dan apabila menang akan menegakkan Negara Islam dengan melaksanakan hukum syariat. Golongan liberal-sekular amat menentang perjuangan ‘menegakkan syariat’ kerana menganggap bercanggah dengan hasrat negara yang demokratik. Pertembungan ini menyebabkan golongan kelompok politikal Islam senantiasa dipandang serong sehingga usaha mendaftarkan parti politik bernuansakan Islam menjadi satu kesukaran walaupun mereka komited dengan proses demokrasi untuk membawa Islam melalui perjuangan politik. Suasana ini menyebabkan ahli politik Islam terpaksa menyegarkan identitinya kepada meyakinkan semua pihak bahawa mereka benar-benar mahukan sebuah negara yang demokratik dan menentang sebarang bentuk kaedah yang bercanggah dengan proses politik. Salah satu usaha ke arah tersebut ialah melalui identiti Muslim Demokrat yang merujuk kepada seorang ahli politik Islam yang memilih untuk berada dalam acuan demokrasi bagi memperjuangkan idealisme perjuangan berpandukan kepada keadilan dan kesaksamaan di samping memahami dengan jelas fiqh waqie’atau fiqh lokal. Dalam konteks Malaysia, fiqh lokal adalah Fiqh Siyasi Manhaj Malayzi atau Fiqh Politik Malaysia amat diperlukan kerana sifat fiqh adalah sesuatu yang cuba mendapat panduan agama dalam pengertiannya secara operasional dan untuk mendapat panduan, hukum-hakam berkenannya mestilah berpijak di bumi nyata dan acuan yang diterima ramai sebagai sistem pemerintahan yang dipakai. #sayajualbuku #kedaibuku #bacabuku #instareading #instaread #reads #bookish #booksaddict #sayajual #sayasukabacabuku #sayasukabaca #bookworm #ulatbuku #instabooks #bookstagram #bookslover #ilovebooks #lovebooks #sukamembaca #membaca #malaysiamembaca #sarawakian #sabahan #malaysian #ilhambooks #MelangkahKeHadapan #LandskapMuslimDemokratDiMalaysia #PolitikMalaysia


0💬Normal

ilovebooks instagram facebook twitter photos videos

Islam & Pemikiran Reformis Masa Hadapan: Mencerahkan Maqasid Yang Digelapkan Selain mengupas konsep dan menggagaskan pembaharuan naratif seperti muwatinun, yakni muafakat dalam masyarakat plural, yang dahulunya dipopularkan melalui konsep li ta’arafu, pengarang turut mengimbau aliran pemikiran reformis Islam semasa, dan antara yang saya kira menarik dalam konteks masyarakat Malaysia adalah dengan mengaitkan persoalan konsep dengan kontroversi pelaksanaan hukum, konsep Negara Islam dan kalimah “Allah”. ANWAR IBRAHIM Ketua Umum Parti Keadilan Rakyat Perkembangan islah dan tajdid tidak dapat dipisahkan dari proses pembaharuan pemikiran serta intelektual yang futuristik melangkaui zamannya. Maka, tidak dapat tidak, pasti akan ada golongan anak muda yang mewakili semangat zaman untuk menggalas amanah gelaran “agen perubahan masyarakat” lantas menjadikan mereka sebagai peneraju tajdidi-islahi. Buku Islam & Pemikiran Reformis Masa Hadapan: Mencerahkan Maqasid Yang Digelapkan adalah sebahagian daripada manifestasi anak muda yang ingin tampil dan mencorak perubahan dalam masyarakat. MOHAMAD RAIMI AB RAHIM Presiden Angkatan Belia Islam Malaysia MUHAMMAD FAISAL ABDUL AZIZ kini merupakan Setiausaha Agung Angkatan Belia Islam Malaysia (ABIM). Sebelumnya pernah menjadi Presiden Persatuan Kebangsaan Pelajar Islam Malaysia (PKPIM). Beliau memperolehi Ijazah Sarjana Muda Undang-undang (LLM) di Universiti Islam Antarabangsa Malaysia. Beliau juga sebelum ini berkhidmat sebagai Peguambela dan Peguamcara khususnya dalam kes melibatkan hak asasi manusia dan kes litigasi kepentingan awam. #sayajualbuku #kedaibuku #bacabuku #instareading #instaread #reads #bookish #booksaddict #sayajual #sayasukabacabuku #sayasukabaca #bookworm #ulatbuku #instabooks #bookstagram #bookslover #ilovebooks #lovebooks #sukamembaca #membaca #malaysiamembaca #sarawakian #sabahan #malaysian #ilhambooks #islamdanpemikiranreformismasahadapan #mencerahkanmaqasidyangdigelapkan #politikmalaysia


0💬Normal

ilovebooks instagram facebook twitter photos videos

Happy #janeawesomewednesday! This week’s prompt is a fashion cover. Look at this fantastic 1970s Pocket Books edition of Pride and Prejudice. There’s some fashion for you! ⁣ 🌷🌷🌷⁣ This @bookbeau has a Jane quote on it, “Run mad as often as you choose but do not faint.” However, they corrected the spelling. This quote is from Jane’s juvenalia work “Love and Freindship” which is full of misspellings, odd capitalizations and other fun wordsmithing. See full passage below. ⁣ 💐💐💐⁣ “My beloved Laura (said she to me a few Hours before she died) take warning from my unhappy End and avoid the imprudent conduct which had occasioned it... Beware of fainting-fits... Though at the time they may be refreshing and agreable yet beleive me they will in the end, if too often repeated and at improper seasons, prove destructive to your Constitution... My fate will teach you this.. I die a Martyr to my greif for the loss of Augustus.. One fatal swoon has cost me my Life.. Beware of swoons Dear Laura.... A frenzy fit is not one quarter so pernicious; it is an exercise to the Body and if not too violent, is I dare say conducive to Health in its consequences—Run mad as often as you chuse; but do not faint."⁣ 🌸🌸🌸⁣ You can swipe for a bit of behind the scenes magic featuring Phoebe who insisted on grabbing two more of my wooden tulips and getting in the photo. 😂😂😂⁣ ⁣ ⁣ ⁣⁣ ⁣⁣ ⁣⁣ ⁣⁣ ⁣⁣ ⁣⁣ ⁣⁣ ⁣⁣ ⁣⁣ ⁣⁣ ⁣⁣⁣⁣ #books #reading #igreads #igbooks #booksofinstagram #booksbooksbooks #bookaddict #booknerd #ilovebooks #bookworm #janeausten #janeite #prideandprejudice #loveandfreindship #awesomeaustenaugust


0💬Normal

ilovebooks instagram facebook twitter photos videos

true believer: books that feature the struggle of belief. good for zealots, extremists, cult leaders, vegetarians, the lapsed, and the saved. subscribe up top if u believe in it.


1💬Normal

ilovebooks instagram facebook twitter photos videos

🔹G I V E A W A Y 🔹 Thanks to @algonquinbooks I have an extra finished copy of Where Are You Calvin Bledsoe by Brock Clarke! Available next Tuesday, August 27th. . "Calvin Bledsoe’s journey begins with the death of his mother. An internationally known theologian and an expert on all things John Calvin, she had been the dominant force in her son’s existence, so much so that he never left home—even when he married—and, as a result, never grew up." (Full synopsis in comments) . To Enter: ✔️Follow me, @crystals_library ✔️Tag two friends in one comment. . Additional entries: ✔️Share this post in your stories and be sure to tag me! (Can be done daily) ✔️Tag additional friends in separate comments. . This Giveaway is not affiliated with Instagram. This Giveaway is US only. Sorry, international friends. No Giveaway accounts. The Giveaway will close on Saturday, August 24th, 2019 at midnight PST. Good luck! . . . #whoareyoucalvinbledsoe #brockclarke #algonquinbooks #algonquin #augustreads #bookstagram #booksoutside #igreads #ilovebooks #booksaremyfriends #alwaysreading #readingaddict #bookishgirl


8💬Normal

ilovebooks instagram facebook twitter photos videos

📔 ada tulisan tentang #raymondcarverterkuburmiinstandiiowa di blog saya. klik link-nya di bio 👆


3💬Normal

ilovebooks instagram facebook twitter photos videos

I keep forgetting to post about this book—finished it last week! 🤓❤️📖 Thanks again for the signed copy @jessica_tom ! I’m no NY Times critic, but I give it 4 out of 4 stars 😉⭐️⭐️⭐️⭐️ . . . I’ll try not to spoil it for anyone, but I want to say a few things about the main character. Initially, I found myself frustrated with Tia. I wanted her to be stronger. And then it hit me. Tia is only 22. You know who else frustrates me and I wish they were stronger? 22 year old ME. Once I connected with the character this way, the book really bloomed for me. It forced me to relive my own early 20s, my struggles to forge meaningful relationships with other women, the way older men played me so easily, the anxiety, the panic attacks, the desire to feel a sense of power over anything in a world that was just rolling me. My experience with the book in a word? Cathartic. I got to see a version of myself free from my inner self-judge. And in that I found love. Love and forgiveness. . . But enough about my trauma 🤣 even if you were never a 22-year-old girl, this book is enjoyable. Well-written, good pacing, and BY GAWD THE FOOD DESCRIPTIONS R 2 DIE FOR. Or something slightly less dramatic 😜🥬🥔🥩🍷🍄


1💬Normal

ilovebooks instagram facebook twitter photos videos

A shadowy afternoon of healthy reading 🌥


1💬Normal

ilovebooks instagram facebook twitter photos videos

Nik Abdul Aziz Nik Mat: Pemikiran dan Kebijakan Berpolitik Sesungguhnya, menelusuri tentang pemikiran dan kebijakan kepimpinan Nik Abdul Aziz lewat buku ini bagaikan berkisah tentang hikayat seribu satu malam. Ini bukan justeru kisahnya bersifat terapung dan tidak berjejak di bumi nyata, tetapi kerana kejujuran diri beliau melahirkan himpunan naratif yang jujur. Pada saya, himpunan tulisan ini berbekas. Penulis tahu bagaimana nak meletak dan mengisikan bekas itu dengan sikap perhambaan tokoh yang dirujuknya. Jauh sekali dari masih bersifat pencarian, tema terbesar buku ini adalah penyerahan setelah Tok Guru menemui jalan pedomannya ke hadapan. Tok Guru bukan lagi mencari bahkan telah menerokai sebuah keyakinan yang lama diimaninya lalu membawanya ke tengah-tengah medan untuk dikongsikan bersama. Tok Guru dan saya - lebih dari bapa dan si anak. Lebih dari kawan biasa. Lebih dari guru di sebuah pertapaan. Tangan beliau yang saya genggami, masih terasa erat. Hujung kaki beliau, enggan saya lepaskan. Kata-katanya, masih berbekas bukan sahaja di telinga saya, bahkan di jiwa. Lantaran itu, dengan kelahiran buku ini, ia menjadi penawar duka perpisahan kami. Catatan yang menyegarkan semula ingatan. Nota-nota untuk bekal perjalanan ke hadapan. Ramuan berkhasiat untuk jiwa dan pemikiran. Peta untuk tidak ralat. Peringatan yang berguna. Dan ukiran sejarah Tok Guru atas kertas memudahkan rakaman sejarah yang berpanjangan. HUSAM MUSA ANUAL BAKRI HARON merupakan Setiausaha Politik kepada Tuan Guru Nik Abdul Aziz Nik Mat, Menteri Besar Kelantan dari 1999 sehingga 2010. Sebelumnya beliau dalam pentadbiran awam sebagai pengawai tadbir diplomatik selama 20 tahun. Beliau mendapat Ijazah Sarjana Muda dalam Pengajian Asia Tenggara dari Universiti Malaya dan pelbagai latihan dan kursus di luar negeri semasa berkhidmat dalam pentadbiran awam #sayajualbuku #bacabuku #instareading #instaread #reads #bookish #booksaddict #sayasukabaca #bookworm #ulatbuku #instabooks #bookstagram #bookslover #ilovebooks #lovebooks #sukamembaca #membaca #malaysiamembaca #sarawakian #sabahan #malaysia #nikaziznikmat #pemikirandankebijakanberpolitik #tgna #tokgurunikaziz


0💬Normal

ilovebooks instagram facebook twitter photos videos

My tired brain and capitalist upbringing (doing hard work and valuing only hard work) unfortunately made me feel like she was doing a lot of sissy whining but then my right brained, depressed self also appreciated her nuance and bitchiness. It’s a good read.


2💬Normal

ilovebooks instagram facebook twitter photos videos

Since I ❤ @danish_mustardreads oh so much and she tagged me in her #bumblebeebookstack , I just knew I had to join in. I love this stack idea and I had WAY more yellow books that I thought. Granted, all of these are unread (for now) but most of them are on my TBR for the next couple months. See any favorites I should prioritize? 📚📖📚 . . Also, tag you're IT to some of my favorite people! Show those BUZZZZZING stacks...okay, lamest joke ever 🐝🤣🐝 . . #books #bookstack #bookish #igbooks #igreads #booksofinstagram #booksofig #reader #bookstagram #bookstagrammer #ilovebooks #booksbooksbooks #bibliophile #bookworm #goodreads #readinggoals #readmorebooks #tbr #bookaholic #bookcollector #neverenoughbooks #fullybooked #stacked


12💬Normal

ilovebooks instagram facebook twitter photos videos

. #currentlyreading . #MurderontheOrientExpress . by #AgathaChristie . . . Good morning 🌄 book lovers 📚 . Sebenarnya genre thriller/mystery bukan genre utama saya. Tapi berhubung entah sudah buku ke berapa romance yg saya baca berakhir dgn zonk, ada baiknya beralih ke sub genre utk pelampiasan 😁 . Ini novel pertama Agatha Christie yg saya baca. Saya justru sudah nonton filmnya ini duluan hampir 2 tahun yg lalu. Berhubung baru punya bukunya (dilempar dari @tiny_shen ) mari kita baca sambil membabat timbunan buku juga. Ada yg mau ikutan baca buku ini? Atau reread lagi bagi yg sedang book slump 😁😁😁 . . . #mystery #thriller #herculepoirot #gramediapustakautama #bukuterjemahan #booksbooksbooks #bookgram #bookphotography #instabook #bookstagram #bookstagrammer #bookstagramfeature #booksofinstragram #readingbooks #ireadromance #romancereader #romancebookaddict #romancebooks #romancenovels #romanceseries #booklover #bookish #bookaddict #ilovebooks #ilovereading #ilovetoread


0💬Normal

ilovebooks instagram facebook twitter photos videos

normally we don’t do this sort of thing, but we’re new to the world, so here are the first books we’re sending out this oct. clockwise: crime, true believer, sick, decorated, i said. subscribe to get some.


1💬Normal

ilovebooks instagram facebook twitter photos videos

Im most creative surrounded by black and white. Reyka Vodka Creme de Cassis 18.21 Lavender Sea Salt Lemon juice Muddled Blackberries 18.21 Chamomile Bitters #entrepreneur #girlboss #creative #1821bitters #lavenderseasaltsyrup #chamomilebitters #cocktailcreation #coffeetablebooks #polaroids #blackandwhite #thehousethatpinterestbuilt #basquiat #o4w #drinklocal #wildafrica #art #lavender #impressionism #design #ilovebooks #studioplexlofts #spxalley


1💬Normal

ilovebooks instagram facebook twitter photos videos

#thechelseagirls Can't put it down!! One of my favorite authors @fionajdavis Historical fiction and NYC landmarks...🤗🤗🤗 #bookstagram #bibliophile #bookworm #ilovebooks #booknerd #booksbooksandmorebooks #mylittlelibrary #bookobsession #instabooks #readersofinstagram #booksniffer


0💬Normal

ilovebooks instagram facebook twitter photos videos

The Martian Chronicles


1💬Normal

ilovebooks instagram facebook twitter photos videos

Pelaksanaan Undang-Undang Islam Di Malaysia: Khayalan Atau Realiti? Buku ini membahaskan isu, masalah, cabaran dan realiti pelaksanaan undang-undang Islam di Malaysia. Perlaksanaan undang-undang Islam yang menyeluruh tetapi mengikut kerangka Perlembagaan bukanlah satu khayalan. Ia memerlu perancangan rapi dengan merujuk kepada kehendak Maqasid Al-Shari’ah, fiqh keutamaan serta tuntutan Siyasah Syari’yyah, jauh sekali laungan retorik. Undang-undang Islam yang pernah menjadi undang-undang utama negara suatu masa dahulu perlu kepada pembaharuan supaya ia sesuai dengan tuntutan zaman. Transformasi undang-undang Islam serta peningkatan taraf Mahkamah Syariah supaya ia setaraf dengan undang-undang sivil dan Mahkamah Sivil hendaklah menjadi agenda penting bagi melihat undang-undang Islam yang menyeluruh dapat direalisasikan. Sama dengan Mahkamah Sivil, kewujudan Mahkamah Syariah adalah untuk memberi keadilan kepada pihak yang terlibat. Meskipun begitu, konflik dan pertembungan antara kedua-dua undang-undang sivil dan Syarak dapat dielakkan dengan mengharmonisasikan kedua-dua undang-undang tersebut. Realitinya, undang-undang Islam boleh dilaksanakan sepenuhnya di Malaysia dengan syarat semua orang Islam mesti mendokong usaha ke arah perlaksanaan undang-undang Islam di Malaysia. Perancangan yang teliti dan rapi dengan mengambilkira kedudukan masyarakat, kerangka Perlembagaan dan hukum Syarak dalam usaha menggubal undang-undang Islam di Malaysia. TAN SRI SYEIKH GHAZALI ABDUL RAHMAN Penasihat, Bahagian Syariah, Jabatan Peguam Negara #sayajualbuku #kedaibuku #bacabuku #instareading #instaread #reads #bookish #booksaddict #sayajual #sayasukabacabuku #sayasukabaca #bookworm #ulatbuku #instabooks #bookstagram #bookslover #ilovebooks #lovebooks #sukamembaca #membaca #malaysiamembaca #sarawakian #sabahan #malaysian #ilhambooks #perlaksanaanundangundangislamdimalaysia #undangundangislam #politikmalaysia


0💬Normal

ilovebooks instagram facebook twitter photos videos

"Bem sei que a vida não vai ser simples,que sempre haverá gente idiota e cínica,provações,injustiças.Sei que as coisas raramente são como deveriam ser,mas acredito ,bem lá no fundo da minha alma,que todos nós provavelmente conseguiremos sobreviver a esta vida cruel. Cuide-se bem.Ame.Arrisque-se. Não desista nunca." #finalizei #books #ilovebooks #editoraarqueiro #maisumpraconta


0💬Normal

ilovebooks instagram facebook twitter photos videos

"Apenas você pode decidir o que a destrói..." . . . #leiturafinalizada #cortedeasaseruina #finalizei #ilovebooks #book #sarahjmaas #somaisumcapitulo #leitura #theend


0💬Normal

ilovebooks instagram facebook twitter photos videos

Travelog Haji Hadi Ramai daripada kita mengelak untuk berbicara soal ibadat haji dan kisah suka duka di sebalik pejalanannya. Ini menyebabkan cerita sebenar tidak disampaikan dengan sempurna. Bukannya bermaksud kita perlu melondehkan aib atau kelemahan mana-mana pihak, tetapi kecenderungan untuk berdiam diri itu timbul kerana ada jemaah haji yang menganggap apa sahaja kejadian atau perkara yang mungkin dianggap ‘kurang elok’ (ujian, cabaran, halangan, kesusahan) sepanjang melaksanakan ibadat haji tidak patut diungkit dan dikongsi, kerana ini hanya akan menjejaskan ‘kemabruran’ haji mereka. Melalui naskhah ini, penulis cuba membuktikan bahawa pemahaman ini tidak tepat. Malah, usaha penambahbaikan sentiasa dilakukan dari semasa ke semasa, sama ada oleh pihak Tabung Haji atau kerajaan Arab Saudi agar perjalanan ibadat haji yang dihadapi oleh para jemaah haji semakin dipermudahkan. Penulis juga cuba membawa pembaca untuk menilai semula pandangan umum masyarakat bahawa ibadat haji perlu ditangguhkan sehingga mencapai usia ‘pencen’, sedangkan ibadat ini harus diisi dengan rukun-rukun yang memerlukan upaya fizikal dan ketahanan mental yang tinggi. #sayajualbuku #kedaibuku #bacabuku #instareading #instaread #reads #bookish #booksaddict #sayajual #sayasukabacabuku #sayasukabaca #bookworm #ulatbuku #instabooks #bookstagram #bookslover #ilovebooks #lovebooks #sukamembaca #membaca #malaysiamembaca #sarawakian #sabahan #malaysian #ilhambooks #traveloghajihadi #traveloghaji #travelog


0💬Normal

ilovebooks instagram facebook twitter photos videos

"Todo mundo pode trair todo mundo."👑 📚 #arainhavermelha #finalizei #books #ilovebooks #leiturafinalizada


0💬Normal

ilovebooks instagram facebook twitter photos videos

"Por amor , ela enganou a morte. Por liberdade, ela se tornará uma arma."❤️❤️ . . . #books #finalizei #leiturafinalizada #cortedenevoaefuria #galerarecord #ilovebooks #amoleitura #inloveporesselivro


0💬Normal

ilovebooks instagram facebook twitter photos videos

Emma Roberts and Atticus! “Love Her, Wild” is Atticus’ first book! 🖤📝 @atticuspoetry


1💬Normal

ilovebooks instagram facebook twitter photos videos

Keganasan Bukanlah Jalan Ke Syurga: Respon Terhadap ISIS Segala puji bagi Allah tuhan semesta alam. Selawat dan salam atas junjungan besar Nabi Muhammad, Nabi kerahmatan dan kebijaksanaan. Begitu juga buat ahli keluarga baginda serta para sahabat yang telah banyak berjasa, semoga selawat dan salam ini sentiasa berkekalan curahannya buat mereka, sehingga hari akhirat. Segala puji bagi Allah tuhan semesta alam. Selawat dan salam atas junjungan besar Nabi Muhammad, Nabi kerahmatan dan kebijaksanaan. Begitu juga buat ahli keluarga baginda serta para sahabat yang telah banyak berjasa, semoga selawat dan salam ini sentiasa berkekalan curahannya buat mereka, sehingga hari akhirat. Nasihat ini saya tujukan kepada golongan pemuda yang mengangkat senjata, menentang negara mereka sendiri, lalu menghancurkan jiwa insan dan tanah air. Kalian telah meninggalkan nilai-nilai mulia yang sabit dalam agama dan memusuhi semua pihak. Saya menyeru kalian agar berhenti dan berfikir sejenak. Dengarkan nasihat ini sekiranya kalian benar-benar mahukan kebaikan buat umat. #sayajualbuku #kedaibuku #bacabuku #instareading #instaread #reads #bookish #booksaddict #sayajual #sayasukabacabuku #sayasukabaca #bookworm #ulatbuku #instabooks #bookstagram #bookslover #ilovebooks #lovebooks #sukamembaca #membaca #malaysiamembaca #sarawakian #sabahan #malaysian #ilhambooks #terorisme #shaykhabdullahbinbayyah #keganasanbukanlahjalankesyurga #ISIS


0💬Normal

ilovebooks instagram facebook twitter photos videos

Y conseguí el último libro de la saga Asylum 😍 tengo unas ganas tremendas de leerlo, me encantó el libro del director que fue cuando el hospital psiquiátrico estaba aún en funcionamiento y me quedé con ganas de saber más 😍 Lo más curioso del día fue que apesar de tener 4 libros nuevos y que ya no tenía espacio para más libros, hoy reacomode mi cuarto y ahora resulta que tengo espacio para muchos más libros nuevos 🤩 jajaja amo mis super poder de "acomodar" y crear espacio donde ya no hay jajaja 😂 #asylum #sagaasylum #madeleineroux #ecapefromasylum #newbook #bookhunting #horrorbooks #imhappy #ilovebooks #completingthesaga


0💬Normal

ilovebooks instagram facebook twitter photos videos

💫Lindo ombligo de semana chic@s 😘 lamento no estar tan activa en la cuenta pero la universidad me esta dejando muchos proyectos 😅vale la pena eso si porque ya me falta poco para terminar la carrera, en fin les platico que mi lectura actual es La dama de las camelias de Alexander Dumas, una lectura conjunta con @tinta_books_music y he de decir que estoy batallando con la historia, es buena si lo reconozco pero aún no me ha enganchado como otros clásicos. Cuénteme que están leyendo y si lo están amando o quieren acabar con esa tortura😊y denle amor a @matatena.bazar por estos hermosos separadores, tan rosas 💕recuerden que tienen 10% de descuento utilizando mi código MatatenaReveal10 ❤Máquina de escribir casera inspirada en @craftingeek ❤Acuarela casera #bookstagram #bookblogger #photoshop #bookphotography #rose #stevenuniverse #sailormoon #rosa #mxicosilee #readabook #readingaddict #ladamadelascamelias #bookstagrammexico #bookstagrammers #ilovebooks #bookaddicts #reads #readforevermore #booksmylove #amoleer #escuela #august #marcapaginas #matatenabazar #bello #ready #bookcommunity #bookobsessed #instabook #ilovereadingbooks


1💬Normal

ilovebooks instagram facebook twitter photos videos

Worth is returning in September 2019 Haven't read the first two books? Get them now and join the group read in Katie's Knights. books2read.com/thesummit books2read.com/thewasteland Katie's Knights https://www.facebook.com/groups/KatiesKnights/


1💬Normal

ilovebooks instagram facebook twitter photos videos

Did you know that if you're a member of @ihgrewardsclub you can get free books sent to your kindle? I am so ready to get behind the scenes of Pixar! Bonus - with @amazonbooks I got an $8 credit to spend on another Great on Kindle book! Basically, it's the gift that keeps on reading (that's how the saying goes, right?!) 📚 Book: #ToPixarandBeyond Author: #lawrencelevy . . . . . #bookstagram #tbr #tbrpile #whatimreading #book #bookblogger #booksofinstagram #books #reading #read #booklife #booksandcoffee #bookish #booklover #booknerd #bookworm #bookish #shelfie #bookclub #ilovebooks #ilovereading #currentlyreading #bookobsessed #spiveys📚club #greatonkindle #kindlepaperwhite #buzzlightyear #stevejobs


0💬Normal

ilovebooks instagram facebook twitter photos videos

Terorisme: Diagnosis dan Penyelesaian Matlamat utama daripada buku kecil ini adalah untuk menjelaskan isu terorisme atau keganasan yang menjadi bualan di seluruh dunia. Malangnya, konsep sebenar tentang dasar dan faktor keganasan telah lenyap daripada kefahaman masyarakat kita rentetan daripada beberapa insiden buruk yang berlaku. Hal yang demikian telah membuahkan kekeliruan, yang kadang kala menyebabkan lebih banyak kerosakan dan mengubah penawar menjadi racun. Bak kata penyair Ahmad Shawqi: Merana kesakitan lebih ringan daripada mengambil ubat yang salah Dalam buku ini saya jelaskan bahawa cara untuk mencabut pohon keganasan daripada ke dasarnya dan menebang pokok keganasan hingga ke hujung akarnya, keganasan itu perlu ditetak dengan kapak hikmah yang berbilah-bilah, supaya pohon toleransi dan kedamaian kemudiannya dapat ditanam, disemai, lalu tumbuh subur. Sesungguhnya idea yang kotor hanya dapat ditumpaskan dengan idea yang baik. Seorang penyair berkata: Kayu busur yang kuat hanya tumbuh daripada akarnya Pohon kurma pula hanya tumbuh jika ditanam pada tempatnya #sayajualbuku #kedaibuku #bacabuku #instareading #instaread #reads #bookish #booksaddict #sayajual #sayasukabacabuku #sayasukabaca #bookworm #ulatbuku #instabooks #bookstagram #bookslover #ilovebooks #lovebooks #sukamembaca #membaca #malaysiamembaca #sarawakian #sabahan #malaysian #ilhambooks #terorisme #shaykhabdullahbinbayyah


0💬Normal

ilovebooks instagram facebook twitter photos videos

Politik Rahmah: Asas-Asas Politik Islam Kontemporari Perbahasan berkenaan dengan politik adalah perbincangan yang tidak ada jemu dan kesudahannya. Ini kerana politik sentiasa berubah pendekatannya yang menuntut perubahan dan ijtihad yang baru untuk menghadapi cabaran-cabaran politik yang baru dan mencabar. Ijtihad yang baru sangat diperlukan di dalam pembentukan politik Islam di alaf baru ini tanpa menafikan ijtihad-ijtihad yang lama yang sesuai dan mempunyai persamaan illah (sebab) dan konsepnya. Politik Islam yang dinginkan pada zaman ini perlu berdiri di atas rahmah, keadilan, syura, kerjasama, menjaga hak semua pihak, menjaga keutuhan agama Islam tanpa menzalimi agama dan bangsa yang lain. Kebenaran ayat “Tidaklah Kami utuskan kamu (wahai Muhammad) melainkan untuk memberi rahmah kepada sekalian alam” akan tercapai apabila suasana negara ini berjalan di atas dasar kasih saying, keadilan dan hormat-menghormati di antara satu sama lain. Kepincangan suasana politik berlaku apabila pemimpin menjadi rakus dan rakyat menjadi pasif. Tidak wujud kerjasama dan interaksi di antara pemimpin dan rakyat untuk mengimarahkan bumi Allah Taala ini. Fikrah al-istikhlaf (wakil Allah atas muka bumi) perlu ditanam kepada semua peringkat sehingga wujudnya pembangunan dan kemajuan yang berteraskan iman dan keamanan. Munculnya buku ini mampu untuk mengisi ruang kosong dalam kalangan pembaca di Malaysia Muslim baik Non-Muslim untuk melihat dengan pandangan yang baru terhadap Malaysia baru yang sudah berubah kepimpinan. Siasah Islam yang baru perlu diperkenalkan kepada semua agar semua peringkat dapat merasai nikmat keadilan dan kasih sayang di atas muka bumi ini. Fauwaz Fadzil Noor #sayajualbuku #kedaibuku #bacabuku #instareading #instaread #reads #bookish #booksaddict #sayajual #sayasukabacabuku #sayasukabaca #bookworm #ulatbuku #instabooks #bookstagram #bookslover #ilovebooks #lovebooks #sukamembaca #membaca #malaysiamembaca #sarawakian #sabahan #malaysian #ilhambooks #politikrahmah#politikislam #panelpenyelidiksiasahrahmah #fauwazfadzilnoor


0💬Normal

ilovebooks instagram facebook twitter photos videos

Hoy llego mi super pedido, un paquete de 3 libros de la saga Magisterium que fue una coperacion entre Cassandra Clare y Holly Black, lo más emocionante fue que los tres libros salieron a un super precio con envío incluido por DHL 😱 porque hasta eso llegaron super rápido 🎉 soy feliz 🤩 #diadepaquetes #maslibros #librosnuevos #magisterium #sagamagisterium #cassandraclare #hollyblack #newsaga #newbooks #ilovebooks #huntingsales #bargain


0💬Normal

ilovebooks instagram facebook twitter photos videos


1💬Normal

ilovebooks instagram facebook twitter photos videos


1💬Normal

ilovebooks instagram facebook twitter photos videos

Seperti yang pernah diceritakan sebelum ini, saya telah berjanji (pada diri sendiri) yang saya tidak akan sentuh siri Harry Potter selagi belum siap projek-projek penulisan tertangguh. Namun setelah berulang kali terpandang di rak kedai-kedai buku, godaannya semakin membara. Jikalau lambat bertindak, silap-silap habis stok nanti. Malang sekali, set hitam yang paling saya dambakan tidak lagi kelihatan. Hmm, tak mustahil sudah disambar licin (banyak kedai saya pusing). Alternatifnya, edisi merah bersulam emas boleh tahan mengancam juga. Saya pun belilah satu. Edisi Gryffindor namanya. Naskhah segar berbungkus plastik. Saya fikir, tak salah pun memilikinya dahulu. Dengan azam, janji asal terus ditepati. Terkenang kembali, lama juga buku ini terperam berbungkus plastik. Cuma silapnya, saya pergi letak atas rak buku yang pasti disapa mata setiap hari. (Mungkin patut sorok dalam laci.) Geram tengok, pada suatu hari saya gagal mengawal diri lantas terkoyak bungkusan plastik. “Aiseh, macam mana boleh ‘tak sengaja’ terkoyakkan ni?” Bisik kata hati dengan penuh rasa berdosa. Alang-alang tidak lagi berbungkus, saya curi-curi baca halaman prakata. Dari prakata, saya fikir apa salahnya pula sekadar selak baca beberapa helaian daripada Bab 1. Dan dari situ, saya terlanjur baca sampai habis buku. Saya tewas pada bisikan syaitan bibliofil. That’s how magical this book is. Lebih aneh lagi sejurus khatam, saya perasan yang saya baca keseluruhan buku ini dalam loghat British. Tak pasal-pasal. Sesungguhnya sama amat menyesal membeli Harry Potter & The Philosopher Stone. Sebab apa? Sebab sekarang saya tak senang duduk selagi tak habis baca keseluruhan siri. Enam buku lagi harus dijejaki.


3💬Normal

ilovebooks instagram facebook twitter photos videos

Who wants book money?! This could be your chance to meet your next book boyfriend on us. It's easy to enter. There's a link in the bio. https://kingsumo.com/g/flunwz/winitwednesday #winitwednesday #authorsofinstagram #writerlife #lovethatlasts #bookstagram #bookworm #books #ilovebooks #readersofinstagram #readers_and_writers #reader #aboutme #gettoknowme #writersofinstagram #writerslife #writersnetwork #writersfollowwriters #writerscommunity #book #booknerd #booklover #booklove #ilovereading #bookaholic


0💬Normal

ilovebooks instagram facebook twitter photos videos

Multiverse is my thing. One of my all time favorite movies is "The other earth" and this book gives some of the same vibes as the movie. This story is so engaging and since I am a romantic I loved this book even more. Great read, mind tripping worthy ⭐⭐⭐⭐⭐ Synopsis Jason Dessen is walking home through the chilly Chicago streets one night, looking forward to a quiet evening in front of the fireplace with his wife, Daniela, and their son, Charlie—when his reality shatters. It starts with a man in a mask kidnapping him at gunpoint, for reasons Jason can’t begin to fathom—what would anyone want with an ordinary physics professor?—and grows even more terrifying from there, as Jason’s abductor injects him with some unknown drug and watches while he loses consciousness. When Jason awakes, he’s in a lab, strapped to a gurney—and a man he’s never seen before is cheerily telling him “welcome back!” Jason soon learns that in this world he’s woken up to, his house is not his house. His wife is not his wife. His son was never born. And someone is hunting him. . . . . . . . . . . . . . . . . . #bibliophile #bookworm #bookstagram #booknerd #booksofinstagram #bookread #book #bookaesthetic #bookaholics #bookrecommendation #bookobsessed #igread #igbookstagram #igbook #ilovereading #ilovebooks #bookstagrammer #reads #readaddict #readallday #readingtime📖 #scifibooks #blakecrouch #blakecrouchdarkmatter


0💬Normal

ilovebooks instagram facebook twitter photos videos

Citação/Reflexão/quote 📝💟 __ #livros #ilovebooks #reflexo #inspiraçes #pensamentos #quotes #citaçes #boanoite


0💬Normal

ilovebooks instagram facebook twitter photos videos

LECTURA RECOMENDADA Un Extraño En Casa Shari Lapena 🌸🌺🌸🌺🌸🌺🌸🌺🌸🌺🌸🌺🌸🌺🌸🌺 Trailer: ¿Por qué huirías de un hogar feliz? Estás en casa preparando la cena. Tu marido está a punto de llegar. Estás deseando verle. Eso es lo último que recuerdas. Despiertas en el hospital sin saber cómo has llegado hasta allí. Te cuentan que has sufrido un accidente; perdiste el control de tu coche mientras conducías a toda velocidad por uno de los peores barrios de la ciudad. La policía sospecha que ocultas algún secreto oscuro, pero tu marido se niega a creerlo. Tu mejor amiga no está tan segura. Y ni siquiera tú sabes qué creer. 🌸🌺🌸🌺🌸🌺🌸🌺🌸🌺🌸🌺🌸🌺🌸🌺 #bookstagram #books #ILOVEBOOKS #BooksLife #bookstagramchile #booklover #book #novela #ShariLapena #UnExtrañoEnCasa


0💬Normal

ilovebooks instagram facebook twitter photos videos

Citação/Reflexão/quote 📝💟 __ #livros #ilovebooks #reflexo #inspiraçes #pensamentos #quotes #citaçes #boanoite


0💬Normal

ilovebooks instagram facebook twitter photos videos

Happy Wednesday, ya'll! 🖤 . QOTD: Who's an author you've recently discovered? . A: I've discovered a bunch of authors this year! Some of them are debut authors like Hafsah Faizal, and others are more established like Deborah Harkness and her Discovery of Witches series. I think I'd like to start reading more from authors that have been around a while. I feel like I've been reading a lot of debut authors lately, and I'd like to branch out and find authors that have more than one book out 😂 Not that I don't enjoy or love supporting new authors, I think I'd just like to read some older but well known series. Like the Mistborn series or some of Joe Abercrombie's stuff. . I hope you're evening has been great! 🖤 . . . . ▪︎Challenges▪︎ #allthebooksaug19 - recommend an audiobook - I recommend Six of Crows! I mean, it's the only audiobook I've listened to so the only one I can recommend 😂 . #bookqueensaug19 - author you recently discovered . . . . . . . #bookstagram #bookstagrammer #booklover #bookworm #booknerd #bookgeek #bookdragon #booklife #bookmagic #bookobsessed #bookaholic #bookaddict #beautifulbooks #ilovebooks #booklove #bibliophile #booksbooksbooks #readerofinstagram #booksofinstagram #bookcommunity #booknerdigans #bookphotography #instabooks #bookishpost #bookaccount #bookaesthetic #bookthoughts


2💬Normal

ilovebooks instagram facebook twitter photos videos

NEW RELEASE #FREE in #KindleUnlimited ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ “If you thought book 1 was good, just wait ‘til you read this. This book was epic.” – Sophie, Goodreads ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ “Told my husband that I couldn’t go on date night because I needed to see what happens.” – Anna’s Bookshelf ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ BLURB Lacey Williams: Good Girl. ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ At Riverbourne Preparatory, that title made me desirable. All a rich boy wants is a pretty and obedient woman on his arm. And I was most definitely both of those things. ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ But at Arcadia High? Being a good girl made me a target. I became a trophy for the spoilt, an end-of-year reward for those willing to play the game: bad boys. ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ Each side wants me so the other can’t have me. Schoolyard bullies who fight over the same damn toy. ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ The city kids have arrived to reclaim what’s theirs, and the country? Well. ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ Those boys sure don’t give in without a fight. ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ *** ⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ #newrelease #arcadiahighanarchists #bullyromance #kindleunlimited #lovetoread #ilovebooks #whattoreadnext #bookstagram #romancebook #naseries #bookblogger #mytbrshelf #goodreadschallenge


1💬Normal

ilovebooks instagram facebook twitter photos videos

⭐️ #SORTEO POR LOS +2K ⭐️ Segunda parte 🙌🏻 . . Hola bebés👀 he vuelto por más! Jeje hoy traigo el segundo sorteo de este especial y en esta ocasión para su deleite, les dejo como premio esta tremenda novedad que @zigzageditorial dejó en mis manos: «Sadie» @summerscourtney. Ahora atentis con lo que deben hacer para partícipse 🙌🏻✨ . 1. Seguir esta cuenta y seguir a @zigzageditorial 2. Comentar esta publicación etiquetando a 2 amixs 3. Compartir esta publicación en sus historias etiquetándome para poder verla ✨ . . Tiene hasta el 30 de agosto para participar cualquier persona que viva en territorio chileno 🇨🇱 (si eres de región, el envío se hace por pagar) . . Juegue ✨🙌🏻♥️


55💬Normal

ilovebooks instagram facebook twitter photos videos

My first day of 6th grade!! 📚📓🤓📖 #firstdayofschool #firstdayof6thgrade #ilovebooks #drmartens #havenauces #lilhavenator


0💬Normal

ilovebooks instagram facebook twitter photos videos

One of my Favorite movies of all time is The NeverEnding Story http://authorlbecker.com/my-favorite-movie/ . . . . #writersofinstagram #writerscommunity #paranormalromance #urbanfantasy #paranormalfiction #author #pagan #writers #writing #fantasy #fiction #bipolar #shy #mentalhealth #books #reading #reader #ilovebooks #poem #poetry #poet #paranormal


0💬Normal

ilovebooks instagram facebook twitter photos videos

Helloooo 🤗 🌷Seguimos con el #retofrutilla y el reto de hoy es un libro rojo y un libro blanco. . . 🍓El libro rojo es: La ira y el amanecer, este libro es un retelling de las mil y una noches. Me gustó pero no me llegó a encantar pero definitivamente tiene lo suyo que lo hace especial. . . 🌼El libro blanco es: En el corazón del mar, este libro es la versión real del libro moby dick , a mi me gustó porque cuenta cosas que nunca me hubiera imaginado que pudieran pasar. . . -Luna🌙 . . #bookstagram #instareads #ilovebooks #lectura #lovetoread  #igreads #bookish #bookscommunity #bookstagramer #readmorebooks #bookslover #bookishfeatures  #booksphilippines #booksphotography #bibliophile #booknerd #bookporn


0💬Normal

ilovebooks instagram facebook twitter photos videos

“Anybody can look at you. It's quite rare to find someone who sees the same world you see.” - John Green, Turtles All the Way Down • • • • • What is your favorite John Green book? • • • • • • • • • • • • • • • • • • #turtlesallthewaydown #johngreen #bookstagram #books #bookish #read #reading #reader #reads #bookstack #bookstagramfeature #bookstagrammer #bookblogger #bibliophile #booked #bookworm #booknerd #bookaholic #bookaddict #bookmail #bookphotography #cozybooks #ilovebooks #libraryofbookstagram #ireadya #bookreccomendations #booksofinstagram #instabooks #igreads


6💬Normal

ilovebooks instagram facebook twitter photos videos

Missing summer break a little today (even though this year’s students seem pretty awesome). Wishing I had a few hours to read with a good view 📖 ———— 📸: @charandbooks #bookstagram #booknerd #instabooks #englishteacher #ilovebooks #readmore


0💬Normal

ilovebooks instagram facebook twitter photos videos

Books and more! That’s what you’ll find here at Green Valley Book Fair from now through September 8th. #greenvalleybookfair #books #magnoliatable #bookfair


4💬Normal

ilovebooks instagram facebook twitter photos videos

hello bookstagram!!! today I recreated a picture from one of my favorite bookstagrammers : @mist.and.books (slide to see the original picture) and I'm really happy with the result!!✨ ----- q o t d: which book are you most excited to read the next year? ----- a: for now I'm really excited to read chain of gold by @cassieclare1 , I can't wait to know more about those characters 💛💛✨ . . . #bookstagram #bookstagramfeature #booklover #instabooks #booknerd #bookishfeatures #bookaddict #aurorarising #bookphotography #read #reading #bookblogger #vscobooks #bookaholic #vscocam #goodreads #booknerdigans  #ilovebooks #bookstagrammer #bookblogger #bookish #booksofinstagram #culturetripbooks #booksbooksbooks #book #books #bookstagram #bookfeaturepage #bookishfeatures #bookstagram #top_bookstagram #bookaesthetic


10💬Normal

ilovebooks instagram facebook twitter photos videos

"No creo que dos personas pudieran ser más felices de lo que hemos sido tú y yo. V." . . . #bookstagram #booknerd #booklover #instabook #quotes #reading #wednesday #ilovebooks #book


7💬Normal

ilovebooks instagram facebook twitter photos videos

« Scrivo. Finché nelle dita si trasmette il dolore che il mio cuore non riesce più a reggere, finché le speranze spezzate e il dolore devastante si fanno un po’ più sopportabili, finché le parole salvano la mia anima creando la tua. » — Ho deciso che dopo Tolstoj mi dedicherò a Mary Shelley. Ho letto “Frankenstein” tantissimi anni fa. Mi era piaciuto, lo so, ma particolari del libro o delle sensazioni provate non ricordo molto, sinceramente. Mi aveva colpito però il fatto che quel romanzo lo avesse scritto una donna. Questo invece, lo ricordo benissimo! Il racconto in versi, accompagnato da splendide illustrazioni, che Lita Judge ha dedicato all’incredibile Mary mi ha fatto venir voglia di leggere e rileggere entrambi. 🦋 —————————————————————————— #classici #books #book #letteratura #libri #letture #monster #instagood #leggere #reader #love #leggeresempre #ioleggo #ilovebooks #amoleggere #booklover #literature #all_shots #illustration #bookaddict #bookobsessed #love #bookworm #passionelibri #bookstagrammer #photo #maryshelley #frankenstein #neripozza #ilcastoroedizioni #litajudge


0💬Normal

ilovebooks instagram facebook twitter photos videos

While reading books from a series, don't you find it difficult to know what to read first and what to read next, 'cause the titles throw you into confusion. We have all been there. (or is it just me? Is there an incantation that I'm not aware of?) It's not the chicken and the egg situation, of course we can always google it, I mean, only we have to do it EVERY OTHER TIME. So, if you ask me it's way too much work (even for a Duology) 🔖 But I recently figured that James Patterson has used a cool ingenious idea to name his books in Women's Murder Club series and it saves you a lot of hassle, 'cause the titles follow a numerical sequence 🔖 Talking of which, I have to say, these books are nail biting thrillers and they ensure that your nerves are on edge. I've read a couple of them (book 2 and 11, ironically not in THE order 😂 A friend sent these books across, so it goes without saying that she didn't follow THE order either 😂) That being said, if you are a whodunit lover, do give this series a shot 🔖 #booksbooksbooks #book #bookstagram #bookstagrammer #photooftheday #bookstagramindia #reader #readers #bookshelf #igbooks #paperback #bookish #bookworm #bookaholic #instabooks #readersofinstagram #goodreads #bookcommunity #bookblogger #booklover #booklove #bookgeek #bookworm #roses #booksofinstagram #booknerds #fiction #bookphotography #ilovebooks #tbr


18💬Normal

Next Page

dekoideen 👍 dekor 💡 dekoracija 💡 dekorieren 💡 mutfakdekorasyon 💡 mutfakdekorasyonu 💡 dekorumah 💡 dekorasyonönerisi 💡 dekoracja 💡 dekorasirumahidaman 💡 dekoracje 💡 dekorasyonönerileri 💡 dekorasiruangtamu 💡 yatakodasidekorasyonu 💡 ahsapdekor 💡 mutfakdekor 💡 salondekorasyonu 💡 dekoratif 💡 duvardekorasyonu 💡 banyodekorasyonu 💡 dekorasidapur 💡 dekorace 💡 dekoration 💡 dekorasiruangan 💡 dekorasyon

counter